<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BAA148375 BAA148375 Singapore 2002 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T 44
2 AZT+DDI 35
3 RTV+SQV 4

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L       E6D, T7TA, K11T, V35T, T39K, K43E, E44A, K122E, D123S, K173I, Q174K, D177E, I178M, T200A, Q207K, R211S, V245E, A272P, E291D, V292I, I293V, E297A, E312A, I326V, I329V, G335D, M357K, G359S, K366R, A371V, A376V, K390R, K395R E89EG
>BAA148375| codons 1-399
PISPIDAVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKELEEAGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWGVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELRKHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTAEAE
LELAENREILKAPVHGVYYDPSKDLVAEVQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDVRQLTEVVQKIVTESIVIWGKTPKFRLPIQRETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, H69K, L89M  
>BAA148375| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Hsu, LY Characterization of mutations in CRF01_AE virus isolates from antiretroviral treatment naive and experienced patients in Singapore. JAIDS, 2005