<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
U1206 02BU.U1206 Burundi 2002 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, G16E, M36I, R41K, L63A, H69K, I93L  
>02BU.U1206| codons 1-99
PQITLWQRPVVTIKIEGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIAIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E28K, K32E, V35T, E36A, T39E, E40D, K49R, V60I, K173V, D177E, T200A, Q207D, R211K, V245K, D250E, A272P, K277R, T286A, E291D, V292I, I293V, Q334H, G335D, R356K, M357R, G359T, T377Q, K390R, A400T, E404D, I411L  
>02BU.U1206| codons 1-428
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIEALTAICEDMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRVQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGHDQWTYQIYQEPFKNLKTGKYAKRRTA
HTNDVKQLTEAVQKIAQESIVIWGKTPKFRLPIQKETWETWWTDYWQATWLPEWEFVNTP
PLVKLWYQ

References
Author Title Citation
Vidal, N HIV type 1 diversity and antiretroviral drug resistance mutations in Burundi. ARHR, 2007