<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
U0702 02BU.U0702 Burundi 2002 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K32E, V35T, E36A, T39E, S48T, V60I, K122E, D123S, I135R, A158S, K173A, D177E, T200A, Q207N, D218X, V245K, D250E, A272P, K277R, T286A, E291D, V292I, I293V, I326V, G333E, R356K, M357L, G359T, K366R, T377M, K390R, A400T, E404D  
>02BU.U0702| codons 1-435
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIEALTAICEEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRNHLLRWGFTTPEKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQEQGQWTYQIYQEPFKNLKTGKYAKLRTA
HTNDVRQLTEAVQKIAMESIVIWGKTPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19V, M36T, N37K, R41N, K45R, H69K, L89M, I93L  
>02BU.U0702| codons 1-99
PQITLWQRPLVSIKVGGQVKEALLDTGADDTVLEETKLPGNWKPRMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Vidal, N HIV type 1 diversity and antiretroviral drug resistance mutations in Burundi. ARHR, 2007