<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
U2226 02BU.U2226 Burundi 2002 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I5V, K11T, V35T, E40D, S48T, K104R, V118I, K122E, D123S, S163T, T165I, K173L, Q174K, D177E, V179I, G196S, T200I, Q207A, R211N, F214L, V245K, E248D, A272P, V276I, T286A, E291D, I293V, P294T, E312D, G335D, R356K, M357K, R358K, G359S, A360T, A371V, I375V, A376V, T377M, A400T, T403M, E404N, K431T, E432D, V435A  
>02BU.U2226| codons 1-436
PISPVETVPVTLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSIPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSTMIKILEPFRLKNPEIII
YQYMDDLYVGSDLEISQHRIKIEELRAHLLNWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPDKDSWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLLRGAKALTDVVTLTEEAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKKST
HTNDVKQLTEVVQKVVMESIVIWGKTPKFKLPIQKETWETWWMNYWQATWIPEWEFVNTP
PLVKLWYQLETDPIAG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L19I, L33V, E35D, M36I, R41K, H69K, L89M  
>02BU.U2226| codons 1-99
PQITLWQRPLVTVKIGGQIKEALLDTGADDTVVEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Vidal, N HIV type 1 diversity and antiretroviral drug resistance mutations in Burundi. ARHR, 2007