<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MYKL1814 04MYKL1814 Malaysia 2004 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA
2 3TC+AZT+IDV+RTV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, Q151M, M184V F116Y     E28G, V35T, T39K, E40G, K43E, V60I, S68G, K122E, D123S, K173I, Q174K, Q207A, R211S, F214L, K238R, I244V, V245E E29G, L34M
>04MYKL1814| codons 20-247
KVKQWPLTGGKIKAMTEICKGLEEEGKISKIGPENPYNTPIFAIKKKDGTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPLDESFRKYTAFTIPSINNET
PGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRIKNPDIVIYQYVDDLYVGSDLEIGQHR
TKIEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDRWTVQPVELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82T   L10I, E35D, M36I, R41K, I62V, I66F, H69K, A71V, I72V, L89M  
>04MYKL1814| codons 1-95
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVRQYD
QVLIEFCGKKVVGTVLVGPTPTNIIGRNMLTQIGC

References
Author Title Citation
Tee, KK Prevalence and pattern of drug resistance mutations among antiretroviral-treated HIV-1 patients with suboptimal virological response in Malaysia. Med Microbiol Immunol, 2006