<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MYKL1779 04MYKL1779 Malaysia 2004 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA
2 AZT+DDI+LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, H69K, L89M  
>04MYKL1779| codons 1-95
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGC

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39K, K43E, D121H, K122E, D123S, K173I, Q174K, D177E, I180V, Q207A, R211S, V245E  
>04MYKL1779| codons 20-247
KVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLHESFRKYTAFTIPSINNET
PGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVVYQYMDDLYVGSDLEIGQHR
TKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Tee, KK Prevalence and pattern of drug resistance mutations among antiretroviral-treated HIV-1 patients with suboptimal virological response in Malaysia. Med Microbiol Immunol, 2006