<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MYKL1665 04MYKL1665 Malaysia 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179D T27P, V106I, D123E, K166R, I180V, T200A  
>04MYKL1665| codons 20-247
KVKQWPLPEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPLDKEFRKYTAFTIPSINNET
PGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIDVYQYMDDLYVGSDLEIGQHR
AKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    R57K, L63P, I64V, I72L  
>04MYKL1665| codons 1-95
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVKQYD
QIPVEICGHKALGTVLVGPTPVNIIGRNLLTQIGC

References
Author Title Citation
Tee, KK Prevalence and pattern of drug resistance mutations among antiretroviral-treated HIV-1 patients with suboptimal virological response in Malaysia. Med Microbiol Immunol, 2006