<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MYKL1620 04MYKL1620.1 Malaysia 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NVP 39
2 3TC+D4T+IDV+RTV 9

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V90I, K122E, S162C, E169D, T200A, R211K  
>04MYKL1620.1| codons 20-247
KVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNET
PGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPDIVIYQYMDDLYVGSDLEIGQHR
AKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L63P  
>04MYKL1620.1| codons 1-95
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGC

References
Author Title Citation
Tee, KK Prevalence and pattern of drug resistance mutations among antiretroviral-treated HIV-1 patients with suboptimal virological response in Malaysia. Med Microbiol Immunol, 2006