<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MYKL1614 04MYKL1614 Malaysia 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA
2 DDI+EFV+LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M   R41K, D60E, L63P, A71V, V77I, I93L  
>04MYKL1614| codons 1-95
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFVKVRQYE
QIPIEICGHKVIGTVLIGPTPANIIGRNLMTQLGC

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74V, M184V, T215Y K219E L100I, Y188L   T39P, D123E, S162A, Q207E, V245T C38F
>04MYKL1614| codons 20-247
KVKQWPLTEEKIKALVEIFPELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKVVDFRE
LNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNET
PGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVIYQYVDDLLVGSDLEIGQHR
TKIEELREHLLRWGFYTPDEKHQKEPPFLWMGYELHPDKWTVQPITLP

References
Author Title Citation
Tee, KK Prevalence and pattern of drug resistance mutations among antiretroviral-treated HIV-1 patients with suboptimal virological response in Malaysia. Med Microbiol Immunol, 2006