<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MYKL1392 03MYKL1392 Malaysia 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 39

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N, Y188L   K20R, V35T, T39K, K122E, D123S, I135L, R172K, K173I, Q174K, D177E, T200A, Q207D, R211K, K238R, V245E  
>03MYKL1392| codons 20-247
RVKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSLNNET
PGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKIKNPEIVIYQYMDDLLVGSDLEIGQHR
AKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDRWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, R57K, H69K, L89M  
>03MYKL1392| codons 1-95
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGC

References
Author Title Citation
Tee, KK Prevalence and pattern of drug resistance mutations among antiretroviral-treated HIV-1 patients with suboptimal virological response in Malaysia. Med Microbiol Immunol, 2006