<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MYKL1356 03MYKL1356 Malaysia 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+EFV 82

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, T215F D67G L100I, K103N   V35K, T39K, K43E, I47F, V60I, S68G, K122E, D123S, I135T, K173I, Q174K, D177E, I178M, V179I, T200E, Q207A, R211S, K223Q, K238R, V245E Y56S, T58I, T84I
>03MYKL1356| codons 20-247
KVKQWPLTEEKIKALKEICKELEEEGKFSKIGPENPSNIPIFAIKKKGGTKWRKVVDFRE
LNKRIQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNET
PGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMIIYQYMDDLYVGSDLEIGQHR
EKIEELRAHLLSWGFFTPDKKHQQEPPFLWMGYELHPDRWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, H69K, L89M  
>03MYKL1356| codons 1-95
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGC

References
Author Title Citation
Tee, KK Prevalence and pattern of drug resistance mutations among antiretroviral-treated HIV-1 patients with suboptimal virological response in Malaysia. Med Microbiol Immunol, 2006