<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CK22-75 03CM2-75 Cameroon 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+IDV 63
2 3TC+EFV+D4T 63

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, L19P, K20I, M36I, R41K, L63S, L89M  
>03CM2-75| codons 1-99
PQITLWQRPIVTVRIGGQPIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QISIEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219E K103N V108I, K238T V35T, T39L, K64R, D123E, I135T, S162A, K173T, Q174K, D177E, I178M, T200A, Q207E, V245Q, T286A, E291D, V292I, I293V, S322T, I326V, G335D, R356K, M357K, R358K, G359S, K366R, T369V, A371V, I375V, K388R, K390R, K395R, E399D, A400T, T403M, E413D, E432D  
>03CM2-75| codons 1-434
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICLEMEKEGKISKIGPENPYNTPV
FAIRKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFFTPDEKHQKEPPFLWMGYELHPDTWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKKSA
HTNDVRQLVEVVQKVATESIVIWGKTPRFRLPIQRETWDTWWMEYWQATWIPDWEFVNTP
PLVKLWYQLEKDPI

References
Author Title Citation
Laurent, C Antiretroviral drug resistance and routine therapy, Cameroon. Emerg Infect Dis, 2006