<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CK22-50 03CM2-50 Cameroon 2003 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+NVP+D4T 26

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, K20R, E35D, M36I, N37D, R41K, H69K, L89M  
>03CM2-50| codons 1-99
PQITLWQRPLVTVKVGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, M184V   Y181C   I5V, K11A, E28K, I31L, K32E, V35T, T39K, S48T, K49R, V60I, D121Y, K122E, I135T, S162C, E169D, K173A, Q174K, G196E, Q207A, R211S, V245Q, D250G, L283I, E291D, I293V, E297A, G335D, R356K, M357R, G359S, T369I, A371V, I375V, K390R, A400T, T403M, E432T  
>03CM2-50| codons 1-433
PISPVETVPVALKPGMDGPKVKQWPLTKEKLEALTEICKEMEKEGKITRIGPENPYNTPI
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPDIVI
CQYVDDLYVGSDLEIEQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKGSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIRGTKALTDVVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKRRSA
HTNDVKQLIEVVQKVATESIVIWGKTPKFRLPIQKETWETWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKTP

References
Author Title Citation
Laurent, C Antiretroviral drug resistance and routine therapy, Cameroon. Emerg Infect Dis, 2006