<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CK22-35 03CM2-35 Cameroon 2003 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 74

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, V82A L33LI L10I, I13V, E35D, M36I, R41K, K45R, L63P, H69K, L89T  
>03CM2-35| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVIEDINLPGKWKPRMIGGIGGFVKVRQYD
QIPIEICGKKAIGTVLVGPTPANIIGRNTLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, T39Q, K66KR, K122E, D123S, S162A, K173T, Q174K, D177E, Q207A, R211S, V245EK, E248D, S251I, K275R, E291D, I293V, P294T, E312N, I326V, G335D, G359S, K366R, T369A, A371V, I375V, K390R, A400T, T403M, E432D Q85QR
>03CM2-35| codons 1-433
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICQEMEKEGKISKIGPENPYNTPV
FAIKKRDSTKWRKLVDFRELNKRTRDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPDKDIWTVNDIQKLVGKLNWASQIYAGIRVKQLCKLLRGTKALTDVVTLTEEAE
LELAENREILKNPVHGVYYDPSKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVRQLAEVVQKVATESIVIWGKTPKFRLPIQKETWETWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDP

References
Author Title Citation
Laurent, C Antiretroviral drug resistance and routine therapy, Cameroon. Emerg Infect Dis, 2006