<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CK22-33 03CM2-33 Cameroon 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 78

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, K122E, I135V, S162A, K173V, Q174K, D177E, I178M, T200E, I202V, E203Q, Q207E, V245E, S251N, K277R, T286A, V292I, I293V, P294T, S322A, I326V, G335D, R356K, M357K, G359S, T369V, A371V, I375V, K390R, E396D, T403L  
>03CM2-33| codons 1-428
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRVKNPEMVI
YQYVDDLYVGSDLEIGQHREKVQELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDNWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEIVTLTEEAE
LELAENREILKEPVHGVYYDPAKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVKQLVEVVQKVATESIVIWGKTPKFRLPIQKDTWEAWWLEYWQATWIPEWEFVNTP
PLVKLWYQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, M36I, R41K, H69K, L89M  
>03CM2-33| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Laurent, C Antiretroviral drug resistance and routine therapy, Cameroon. Emerg Infect Dis, 2006