<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CK22-31 03CM2-31 Cameroon 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+IDV+D4T 35

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10IV, I13V, K14R, L19P, K20I, M36I, R41K, H69K, L89M  
>03CM2-31| codons 1-99
PQITLWQRPVVTVRIGGQPIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K11Q, K122E, D123G, S162A, K173T, Q174N, D177E, I178V, T200A, Q207D, R211K, V245Q, A272P, V276I, E291D, V292I, I293V, S322A, I326V, A327V, R356K, M357K, G359S, T369V, A371V, I375A, K390R, T403M, E432D V35KN
>03CM2-31| codons 1-433
PISPIETVPVQLKPGMDGPKVKQWPLTEEKIKALNEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTNNPEVVI
YQYVDDLYVGSDLEIGQHRAKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPAKDLVVEIQKQGQGQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVKQLVEVVQKAATESIVIWGKTPKFRLPIQKETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDP

References
Author Title Citation
Laurent, C Antiretroviral drug resistance and routine therapy, Cameroon. Emerg Infect Dis, 2006