<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CK22-25 02CM2-25 Cameroon 2002 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 39
2 3TC+AZT+EFV 39

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L89AMTV I13V, K14R, K20I, M36I, R41K, H69K, I72V  
>02CM2-25| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAVGTVLVGPTPVNIIGRNVLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V       V35T, E36D, K122E, D123DN, I135V, S162A, K173AE, Q174K, D177E, T200A, E203EK, Q207E, R211K, P243T, V245Q, T286A, E291D, V292I, I293V, S322T, I326V, G335D, R356K, M357K, G359S, K366R, A371V, I375V, K390R, T403R, Q428H  
>02CM2-25| codons 1-433
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFREKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIKELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQTIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVRQLTEVVQKVATESIVIWGKTPKFRLPIQKETWEAWWREYWQATWIPEWEFVNTP
PLVKLWYHLEKEP

References
Author Title Citation
Laurent, C Antiretroviral drug resistance and routine therapy, Cameroon. Emerg Infect Dis, 2006