<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CK22-2 02CM2-2 Cameroon 2002 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 61

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184I   K101E, K103N   E28K, V35T, T39A, K43N, V90I, K104R, K122E, D123N, I135V, S162A, K173I, Q174K, D177E, I178M, G196E, T200A, Q207G, V245Q, T286A, T290S, E291D, V292I, I293V, P294T, E312D, S322A, I326V, G335D, R356K, M357K, G359S, A371V, I375V, K390R, T403M, E404D  
>02CM2-2| codons 1-429
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIKALTEICAELENEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLEKNRSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRIKNPEMVI
YQYIDDLYVGSDLEIEQHRAKIEELRGHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALSDIVTLTEEAE
LELAENREILKDPVHGVYYDPAKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVKQLTEVVQKVATESIVIWGKTPKFRLPIQKETWEAWWMDYWQATWIPEWEFVNTP
PLVKLWYQL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, M36I, R41K, H69K, L89M  
>02CM2-2| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Laurent, C Antiretroviral drug resistance and routine therapy, Cameroon. Emerg Infect Dis, 2006