<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CK2-91 02CM-91 Cameroon 2002 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 3TC+IDV+D4T 13
2 3TC+EFV+D4T 13

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35D, M36I, R41K, L63P, H69K, L89M  
>02CM-91| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    G190E   K20R, V35T, T39K, K43E, V60I, K122P, D123E, I135V, S162C, K173A, Q174K, D177E, I178M, T200A, Q207E, R211K, V245Q, A272P, K275R, T286A, E291D, V292I, I293V, E297A, G335D, R356K, M357R, R358K, G359S, A371V, I375A, T377I, T386I, K390R, A400T, E404D, K431T, V435A  
>02CM-91| codons 1-438
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DPEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAKNPEMVI
YQYMDDLYVESDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKRKSA
HTNDVKQLTEVVQKAAIESIVIWGKIPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLETEPIAGAE

References
Author Title Citation
Laurent, C Antiretroviral drug resistance and routine therapy, Cameroon. Emerg Infect Dis, 2006