<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CK2-84 02CM-84 Cameroon 2002 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 52
2 3TC+NFV+D4T 105

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L10F, L33I, N88G I13V, E35D, M36I, N37E, R41K, V56A, I62V, L63P, H69Y, A71T, I72T  
>02CM-84| codons 1-99
PQITLWQRPFVTVKIGGQLKEALLDTGADDTVIEDIELPGKWKPKMIGGIGGFIKARQYD
QVPIEICGYKTTGTVLVGPTPVNIIGRGLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Q151M, M184V F116Y     V35T, S48E, K49R, V60I, K64R, S68R, V118I, D123E, R172K, D177E, I178L, Q207E, R211K, F214L, V245T, D250E, A272P, T286A, I293V, I329V, Y339W, A360T, A376S, K390R, T403M Q182H
>02CM-84| codons 1-438
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIERIGPENPYNTPI
FAIRRKDRTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFKKQNPELVI
YHYVDDLYVGSDLEIGQHRTKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGQGQWTWQIYQEPFKNLKTGKYARMRGT
HTNDVKQLTEAVQKISTESIVIWGKTPKFRLPIQKETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAE

References
Author Title Citation
Laurent, C Antiretroviral drug resistance and routine therapy, Cameroon. Emerg Infect Dis, 2006