<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CK2-66 02CM-66 Cameroon 2002 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 45
2 3TC+EFV+D4T 46

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N K238N T27P, V35T, K122E, I135V, S162F, K173T, Q174K, D177E, T200E, E203Q, Q207N, V245E, E248D, K281R, T286A, E291D, V292I, I293V, E312G, G335D, F346Y, R356K, M357K, G359S, A371V, I375V, I382V, K390R, A400T, T403Q, E432D, V435I  
>02CM-66| codons 1-435
PISPIETVPVKLKPGMDGPKVKQWPLPEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQFSMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHREKIQELRNHLLRWGFTTPDKKHQKEPPFLWMGYELHPDNWT
VQPIELPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDIVPLTEEAE
LELAENREILKGPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPYKNLKTGKYAKKRSA
HTNDVKQLTEVVQKVATESIVVWGKTPKFRLPIQKETWETWWQEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPII

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, M36I, R41K, H69K, L89M  
>02CM-66| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Laurent, C Antiretroviral drug resistance and routine therapy, Cameroon. Emerg Infect Dis, 2006