<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CK2-47 02CM-47 Cameroon 2002 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 43

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12K, I13A, K14R, K20I, M36I, R41K, H69K, L89M  
>02CM-47| codons 1-99
PQITLWQRPLVKARIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, V90I, K122T, A158T, S162A, K173T, D177E, T200A, Q207D, V245K, K275R, V276I, T286A, E291D, V292I, I293V, P294V, S322A, D324E, G335D, R356K, M357R, R358K, G359S, I375V, T377Q, K390R, K395R, T403S, E432D  
>02CM-47| codons 1-437
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DTDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPTIFQASMTKILEPFRTQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRDHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIRIKQLCKLLRGAKALTDIVVLTEEAE
LELAENREILKEPVHGVYYDPAKELIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKRKSA
HTNDVKQLTEAVQKVAQESIVIWGKTPKFRLPIQRETWEAWWSEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGA

References
Author Title Citation
Laurent, C Antiretroviral drug resistance and routine therapy, Cameroon. Emerg Infect Dis, 2006