<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CK2-44 02CM-44 Cameroon 2002 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 43

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V   K103N, Y188L   V35T, T39A, K102Q, I135V, S162A, K173T, Q174K, D177E, T200A, Q207E, V245Q, E248K, K275R, T286A, E291D, V292I, I293V, P294T, S322T, G335D, R356K, M357K, G359S, A371V, I375A, K390R, K395R, T403M, E432D, V435A  
>02CM-44| codons 1-438
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYVDDLLVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPKKDSWTVNDIQKLVGKLNWASQIYAGIRVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVKQLTEVVQKAATESIVIWGKTPKFRLPIQRETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIAGAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, M36I, N37D, R41K, H69K, L89M  
>02CM-44| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Laurent, C Antiretroviral drug resistance and routine therapy, Cameroon. Emerg Infect Dis, 2006