<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
01TZA359 01TZA359 Tanzania 2001 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, L19V, K20R, E35D, M36I, R41K, R57K, L63S, H69K, L89M  
>01TZA359| codons 1-99
PQITLWQRPLVSIKIGGQVREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QISIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Arroyo, MA HIV type 1 subtypes among blood donors in the Mbeya region of southwest Tanzania. ARHR, 2004