<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
01TZA301 01TZA301 Tanzania 2001 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, M36I, N37T, R41K, I62V, L63P, H69K, T74A, L89M, I93L  
>01TZA301| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEEITLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGKKAIGAVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V8I, V35M, E36V, T39E, S48T, K103R, K122E, D123G, K166R, K173T, Q174R, T200A, Q207E, R211K, F214L, V245K, D250E, A272P, T286A, E291D, V292I, I293V, I326V, Q334H, G335D, R356K, G359T, A371T, A376C, T377M, K390R, A400T, E404D, V435I, R461K, V466I, D471E, T477A, H483Q, L491S, I495V, S519N, K530R, V531I, A534S, A554S  
>01TZA301| codons 1-560
PISPIETIPVKLKPGMDGPKVKQWPLTEEKIKALMVICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRTRNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGHDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTETVQKICMESIVIWGKTPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETFYVDGAANRETKLGKAGYVTDKGRQKIVSLTETTNQKAELQ
AIQLALQDSGSEVNVVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKERIYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D25E, V31I, M50T, F100Y, L101I, T112V, T124A, T125A, K136Q, V201I, T218I, L234I, A265V, R269K, D278A S283G
>01TZA301| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASEFNLPPIVAKEIVASCDKCQLKGEATHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYYILKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIKDYGKQMAGADCVAGRQDED

References
Author Title Citation
Arroyo, MA HIV type 1 subtypes among blood donors in the Mbeya region of southwest Tanzania. ARHR, 2004