<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
139089 139089 Russia 2004 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  V151I E11D, R20K, V31VI, S39SN, L101I, T122I, T124A, T206S  
>139089| codons 1-288
FLDGIDKAQEDHEKYHSNWKAMASDFNLPPVVAKEIVANCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSN
FISATVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIASDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, T12S, E35D, N37E, L63P, C67H, A71T, I72K, I93L  
>139089| codons 1-99
PQITLWQRPIVSIKIGGQLKEALLDTGADDTVLEDMELPGRWKPKMIGGIGGFIKVRQYD
QIPIEIHGHKTKGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K102R, I142F, S162C, S163T, K166R, I178M, V245E, A272P, T286A, E291Q, E297K, K311R, G333E, R356K, K366R, T369V, Q373H, A376T, T377M, A400T, V435T, L469F, T470N, L491A, V531I, A554S  
>139089| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGFRYQYNVLPQGWKGSPAIFQCTMTRILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTQVIPLTKEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQEQGQWTYQIYQEPFKNLKTGKYAKMRGA
HTNDVRQLVEAVHKITMESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPITGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSFNDTTNQKTELQ
AIHLALQDSGAEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKIYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Galkin, AN Full-length genomic sequencing and analysis of four HIV type 1 subtype B isolates circulating in the territory of Russia. ARHR, 2006