<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ARE933 ARE933 Argentina 2004 HIV1 F PBMC Genomic

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, S17N, I72V, I84L, L101I, S119P, T124A, T125A, A129S, K136Q, A205S, K211R, T218I, L234V, D256E V110A, V281M, S283G
>ARE933| codons 1-288
FLDGIDKAQEDHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYLEAEVIPAETGQETAYFILKLAGRWPAKTIHTDNGPN
FTSAAVKASCWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIISTDIQTRELQKQIIKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCMAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  G73C T12A, K14N, E35D, M36I, R41K, R57K, Q61N, I72T, L89M, N98H I85F, R87I
>ARE933| codons 1-99
PQITLWQRPLVAINIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NILIEICGHKATCTVLVGPTPVNIFGINMLTQIGCTLHF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6K, I31L, V35S, T39I, K122E, I135V, S162C, K173T, Q174K, I178M, Q207K, R211T, V245Q, A272P, T286A, E291D, V292I, I293V, E297A, F346L, G359S, T377Q, Q394L, E399D, A400T, T403I, K431T, V435A, A446S, L452K, V466A, S468P, D471E, T477A, Q480K, I482V, H483Q, L491A, S519N, V559I N57NDHY, N265K, E404S, Y405I
>ARE933| codons 1-560
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKLKALSEICIEMEKEGKISKIGPENPYYTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTKNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEELRKHLLTWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLKWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPLKNLKTGKYARMRSA
HTNDVKQLTEAVQKIAQESIVIWGKTPKFKLPILKETWDTWWISIWQATWIPEWEFVNTP
PLVKLWYQLETEPIAGAETFYVDGASNRETKKGKAGYVTDRGRQKAVPLTETTNQKAELK
AVQLALQDSGAEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKIL

References
Author Title Citation
Aulicino, PC Circulation of novel HIV type 1 A, B/C, and F subtypes in Argentina. ARHR, 2005