<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA
2 NNRTI+NRTI+PI 462

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I50IV, I54V, V82VA Q58E I15V, K20T, E35D, M36I, R57K, I62V, L63P, A71T, I72V, V77I, I93L K45MI
>CA71568| codons 1-99
PQITLWQRPLVTIKVGGQLTEALLDTGADDTVLEDINLPGRWKPMMIGGVGGFVKVKEYD
QVPIEICGHKTVGTVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215F K219Q     K173N, I202V, H208Y, R211K, L228R, A272S, T286A  
>CA71569| codons 1-311
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRNQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQYLLKWGFFTPDQKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGAKALTEVIPLTEEAE
LELAENREILK

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010