<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1317 CA71566 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI NA
2 3TC+ AZT+ DDI NA
3 None 3
4 D4T+ DDI+ IDV 53
5 3TC+ AZT+ SQV 37
6 None 6
7 D4T+ IDV+ NVP+ RTV 16
8 3TC+ ABC+ AZT+ LPV+ SQV 77
9 3TC+ EFV+ LPV+ TDF 4
10 None 11
11 TDF+ LPV+ EFV+ 3TC 48
12 Unknown 172

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L90M L10F, V11I, L33LI, N88G I13L, I15V, K20T, E35N, M36I, N37D, R41K, V56A, R57K, Y59YH, I62V, L63P, C67Y, A71L, I93L  
>CA71566| codons 1-99
PQITLWQRPFITLKVGGQLTEALLDTGADDTVIENIDLPGKWKPKIIGGIGGFVKAKQHD
QVPIEIYGHKLIGTVLVGPTPVNIIGRGLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M A62V, K70N, V75I, F77L, F116Y Y181C, Y188L   P4PS, K20R, E40K, K43E, K46Q, K49KR, T58N, T69TI, K102G, K103KR, K122E, D123DN, G141A, S162N, P170S, Q174K, I178IM, V189VI, T200A, Q207E, R211K, F214FL, L228H, V245T, E248DN, D250E, S251D, A272P, T286A, A288S, V292I, E297K K219AT, V261KR
>CA71567| codons 1-311
PISSIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTKMEEEGQISRIGPENPYNNPV
FVIKKKDSINWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKGRKSVTVLDVGDAFYSVPL
DENFRKYTAFTIPSINNETPAIRYQYNVLPMGWKGSPAIFQNSMTKILESFRKKNPDMVI
CQYMDDLLIGSDLEIGQHRAKIEELREHLLKWGLTTPDAKHQKEPPFHWMGYELHPDKWT
VQPITLPDKEDWTVNDIQKLKGKLNWASQIYPGIKVKQLCKLLRGAKSLTEIIPLTKEAE
LELAENREILK

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010