<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JKC-VI1126 VI1126 DRC 1994 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 Unknown NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, V31I, Y99F, L101I, T112I, T122I, T124A, K136Q, V165I, T206S, K211R, E212A, L234I, D256E P142S, S283G
>VI1126| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAFFILKLAGRWPVKIIHTDNGSN
FISATVKAACWWAGIQQEFGISYNPQSQGVVESMNKELKKIIGQIRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIASDIQTRALQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, K20R, E35D, M36I, R41K, I62V, L63V, I64M, H69Q, L89M  
>VI1126| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QVVMEICGQKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219E     V35T, T39L, V60I, T69N, K122P, D123E, I135V, I142V, S162Y, K173T, Q174K, D177E, I178M, Q207E, V245Q, E248D, D250E, S251D, A272P, L283I, T286A, A288T, E291D, V292I, I293V, E297A, F346Y, G359S, S379G, K390R, A400T, K431T, E432D, V435A, L452K, K454R, R461K, D471E, A481T, H483Y, L491S, L503I, S519N, K527Q, E529D, K530Q, V531I, A534S, A554S W266R
>VI1126| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICLEMEKEGKISKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DPEFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQYSMTKILEPFRTKNPEMVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFFTPDEKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKEDWTVNDIQKLVGKLNRASQIYPGIKVKQLCKLIRGAKTLTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPYKNLKTGKYARMRSA
HTNDVKQLTEAVQKIATEGIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETDPIAGAETFYVDGAANRETKKGRAGYVTDKGRQKVVSLTETTNQKTELQ
TIYLALQDSGSEVNIVTDSQYAIGIIQAQPDKSESELVNQIIEQLIQKDQIYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Carr, JK Direct Genbank submission: HIV-1 isolates from the Democratic Republic of the Congo and from Gabon. Direct Genbank Submission, 1999