<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NP1623 NP1623 Thailand 1999 HIV1 B PBMC Genomic

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, S17C, A91T, L101I, S119R, T125S, V165I, K211R, S230N, A265V L241P
>NP1623| codons 1-288
FLDGIDKAQEDHEKYHCNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPTETGQETAYFILKLAGRWPVKTIHTDNGRN
FTSTSVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQIRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTRELQKQITKIQNFRVYYRDNRDPLWKGPAK
PLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, L63P, I93L  
>NP1623| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I135V, V245M, K277R, Q278E, E298A, K311R, E312T, Q334L, P345Q, F346Y, D364E, I411V, E432D, I434M, V435E, D460N, R461K, S468T, Q520R, Q524E, V548I  
>NP1623| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRELCKLLRGTKALTEVIPLTEAAE
LELAENREILRTPVHGVYYDPSKDLIAEIQKQGLGQWTYQIYQEQYKNLKTGKYARMRGA
HTNEVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEAWWTEYWQATWVPEWEFVNTP
PLVKLWYQLEKDPMEGAETFYVDGAANRETKLGKAGYVTNKGRQKVVTLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSRIIEELIKKEKVYLAWVPAHK
GIGGNEQIDKLVSAGIRKVL

References
Author Title Citation
Tovanabutra, S First CRF01_AE/B recombinant of HIV-1 is found in Thailand. AIDS, 2001