<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JKC-SE6954 VI6954 Sweden 1993 HIV1 D PBMC Genomic

Treatment History
Order Regimen Weeks
1 Unknown NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, M50L, I72V, K111R, T112V, I113V, T125A, K173R, V201I, K215R, L234I, D256E, A265V  
>VI6954| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQLKGEALHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVRVVHTDNGSN
FTSTAVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLRTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQRQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20R, M36I, R41K, H69Y, T96A  
>VI6954| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGYKAIGTVLVGPTPVNIIGRNLLTQIGCALNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11Q, V35T, S48A, K49R, V60I, D121Y, K122E, D177E, I178M, T200I, Q207G, R211K, V245T, D250E, A272P, K277R, L282C, L283I, T286A, I293V, G335D, P345Q, F346Y, R356K, M357V, A360T, V365I, E370A, T377Q, S379C, K390R, A400T, E432D, I434M, S468P, D471E, Q480H, L491S, A534S, K540R, A554N, V559I  
>VI6954| codons 1-560
PISPIETVPVQLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIARIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKCIRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEQYKNLKTGKYAKVRGT
HTNDIKQLTAAVQKIAQECIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPMVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVPLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLSWVPAHR
GIGGNEQVDKLVSNGIRKIL

References
Author Title Citation
Wilbe, K Characterization of novel recombinant HIV-1 genomes using the branching index. Virology, 2003
Carr, JK Direct Genbank submission: HIV-1 isolates from the Democratic Republic of the Congo and from Gabon. Direct Genbank Submission, 1999