<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
92UG037 92UG037 Uganda 1992 HIV1 A PBMC MC

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, V31I, I72V, I84V, T112V, I113V, T124A, T125A, G134N, I135V, D167E, V201I, T206S, I208L, N222K, L234I, A265V, R269K Y226C, S283G
>92UG037| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYVEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGSN
FTSAAVKAACWWANVKQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDLQTKELQKQITKIQKFRVCYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIKDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E21K, E35D, M36I, R41K, R57K, H69K, L89M, Q92L  
>92UG037| codons 1-99
PQITLWQRPLVTVKIGGQLKKALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTLIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6S, K20R, V21I, V35T, T39A, E40D, K43R, K46R, V60I, K122E, D123S, I135T, S162A, K173S, Q174K, Q207E, R211K, V245E, D250E, E291D, V292I, I293V, P294T, E312D, V317A, G335D, T338I, M357K, G359S, T369A, A371V, I375V, A376V, T377M, A400T, T403M, E404D, W410*, E432D, V435A, D471E, Q480H, L491S, K512R, S519N, Q524K, K527E, E529D, A534S, A554S  
>92UG037| codons 1-560
PISPISTVPVKLKPGMDGPRIKQWPLTEEKIKALTEICADMEREGRISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRSKNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTDIVTLTEEAE
LELAENREILKDPVHGAYYDPSKDLIAEIQKQGQDQWIYQIYQEPFKNLKTGKYARKRSA
HTNDVKQLAEVVQKVVMESIVIWGKTPKFKLPIQKETWETWWMDYWQAT*IPEWEFVNTP
PLVKLWYQLEKDPIAGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNQIIEKLIEKDKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Gao, F Molecular cloning and analysis of functional envelope genes from human immunodeficiency virus type 1 sequence subtypes A through G. The WHO and NIAID networks for HIV isolation and characterization. J Virol, 1996
Gao, F The heterosexual human immunodeficiency virus type 1 epidemic in Thailand is caused by an intersubtype (A/E) recombinant of African origin. J Virol, 1996