<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
98ZA528 98ZA528 South Africa 1998 HIV1 C PBMC Genomic

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D25E, V31I, L45Q, M50I, I72V, P90S, F100Y, L101I, T112V, S119T, T124A, T125A, K136Q, Q216R, T218I, K219Q, L234I, D278A S283G
>98ZA528| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASEFNLPPIVAKEIVASCDKCQQKGEAIHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVISAETGQETAYYILKLAGRWPVKVIHTDNGTN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKRIIQIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGADCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  I47M T12S, I15V, G16E, L19T, M36I, L63P, H69K, L89M, I93L  
>98ZA528| codons 1-99
PQITLWQRPLVSIKVEGQTKEALLDTGADDTVLEEINLPGRWKPKMMGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, E40D, S48T, K122E, D123S, K173A, D177G, T200A, Q207E, R211K, V245Q, K277R, T286A, E291D, V292I, P294S, Q334H, G335D, R356K, G359T, T377M, K390R, A400T, E404D, V435A, A437V, V466I, S468T, D471E, T477S, H483Q, L491S, S519N, K530R, A534S, A554S  
>98ZA528| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEDMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPGIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTDIISLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGHDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIAMESIVIWGKTPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGVETFYVDGAANRETKLGKAGYVTDRGRQKIVTLTETTNQKSELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKERVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Hunt, GM Characterization of near-full length genome sequences of three south African human immunodeficiency virus type 1 subtype C isolates. Virus Genes, 2003