<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
98USHVTN941c1 98_941c1 U.S. 1998 HIV1 B PBMC MC

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S24A, D25N, S119T, T124N, T125V, E198D, V201I, T206S, D256E  
>98_941c1| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMAANFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGTN
FTSNVVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGDRIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15V, L19I, R41K, L63P R87K
>98_941c1| codons 1-99
PQITLWQRPLVTIRVGGQIKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGKNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6K, V35I, E42K, E44K, S68G, K122E, I135T, K166R, G196E, V245K, K277R, A288S, I293V, E297A, L301M, S379G, V381I, K385R, K390R, A400T, T403M, E404K, K431T, L491S, E529D G359E
>98_941c1| codons 1-560
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMKKKGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKSLTEVVPLTAEAE
MELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMREA
HTNDVKQLTEAVQKIATEGIIIWGRTPKFRLPIQKETWETWWMKYWQATWIPEWEFVNTP
PLVKLWYQLETEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTDTTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKDKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
McLaughlin, S Sequence diversity of HIV-1 genomes from the HIV vaccine trials network. Direct Genbank Submission, 2004