<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
98USHVTN8229c6 98_8229c6 U.S. 1998 HIV1 B PBMC MC

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    L101I, T124N, T125V, I135V, D167E, I208L, K211Q, D232E, D256E  
>98_8229c6| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSN
FTSNVVKAACWWAGVKQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDLQTQELQKQITKIQNFRVYYRDSREPLWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, M36I, L63P, I72V  
>98_8229c6| codons 1-99
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P14S, V35I, S68G, D123E, K166R, V245E, A272P, K277R, T286A, R356K, I375V, T403M, P421S, V435A, T450A, L452V, T470N, A502V, L517I, S519N, A554S N265D
>98_8229c6| codons 1-560
PISPIETVPVKLKSGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLDWASQIYPGIKVRQLCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKMRGA
HTNDVKQLTEAVQKVATESIVIWGKTPKFKLPIQKETWEAWWMEYWQATWIPEWEFVNTP
SLVKLWYQLEKEPIAGAETFYVDGAANREAKVGKAGYVTDRGRQKVVSLNDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYVLGIIQAQPDKSESEIVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
McLaughlin, S Sequence diversity of HIV-1 genomes from the HIV vaccine trials network. Direct Genbank Submission, 2004