<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TZBFL0011 TZBFL0011 Tanzania 1996 HIV1 D PBMC MC

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  L74M S17N, M50L, I72V, G106R, T112V, I113V, T124A, T125A, D167E, V201I, L234I, D256E, A265V S283G
>TZBFL0011| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQLKGEALHGQVDCSPGI
WQLDCTHLEGKVIMVAVHVASGYIEAEVIPAETGQETAYFLLKLARRWPVKVVHTDNGSN
FTSAAVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKVKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, M36I, N37K, R41K, I64V, C67D, T91A  
>TZBFL0011| codons 1-99
PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLEEIKLPGKWKPKMIGGIGGFIKVRQYD
QILVEIDGHKAIGTVLVGPTPVNIIGRNLLAQIGCTLNF

References
Author Title Citation
Koulinska, IN Common genetic arrangements among human immunodeficiency virus type 1 subtype A and D recombinant genomes vertically transmitted in Tanzania. ARHR, 2002