<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JKC-VI354 VI354 Gabon 1998 HIV1 CRF02_AG PBMC Genomic

Treatment History
Order Regimen Weeks
1 Unknown NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, K14R, R20K, V31I, L101I, T112V, S119T, T124A, T125A, G134N, I135V, K136T, V201I, T206S, T218I, L234I, D256E S283G
>VI354| codons 1-288
FLDGIDKAQEDHERYHSNWKAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGTN
FTSAAVKAACWWANVTQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, M36I, P39L, R41K, I62V, L63P, H69K, V82I, L89M  
>VI354| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEEINLLGKWKPKMIGGIGGFIKVRQYD
QVPIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  N348I     V35T, T39N, K43Q, K49R, V60I, W88C, D121Y, K122E, D123G, K126R, D177E, I178M, T200A, Q207A, R211K, P243T, I244V, V245K, A272S, T286A, E291D, V292I, I293V, I326V, I329V, Q334P, G335D, R356K, M357K, G359S, T386I, A400T, E404D, Y405H, P421H, K431T, L452Q, V466I, D471E, K476R, L491P, S519N, Q524K, K527Q, E529N, A534S, Q547K M16I
>VI354| codons 1-560
PISPIETVPVKLKPGIDGPKVKQWPLTEEKIKALTEICNEMEQEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEGFRRYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQTVKLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEVQKQGPDQWTYQIYQEPFKILKTGKYAKKRSA
HTNDVKQLTEAVQKIATESIVIWGKIPKFKLPIQKETWETWWTDHWQATWIPEWEFVNTP
HLVKLWYQLETEPIVGAETFYVDGAANRETKQGKAGYVTDRGRQKIVSLTETTNQRTELQ
AIHLALQDSGPEVNIVTDSQYALGIIQAQPDKSESELVNQIIEKLIQKNKVYLSWVPAHK
GIGGNEKVDKLVSAGIRKVL

References
Author Title Citation
Carr, JK Direct Genbank submission: HIV-1 isolates from the Democratic Republic of the Congo and from Gabon. Direct Genbank Submission, 1999