<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JKC-VI354 VI354 Gabon 1998 HIV1 G PBMC Genomic

Treatment History
Order Regimen Weeks
1 Unknown NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, K14R, R20K, V31I, L101I, T112V, S119T, T124A, T125A, G134N, I135V, K136T, V201I, T206S, T218I, L234I, D256E S283G
>VI354| codons 1-288
FLDGIDKAQEDHERYHSNWKAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGTN
FTSAAVKAACWWANVTQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, M36I, P39L, R41K, I62V, L63P, H69K, V82I, L89M  
>VI354| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEEINLLGKWKPKMIGGIGGFIKVRQYD
QVPIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Carr, JK Direct Genbank submission: HIV-1 isolates from the Democratic Republic of the Congo and from Gabon. Direct Genbank Submission, 1999