<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RL42 RL42 China 1998 HIV1 B PBMC Genomic

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  N155D S17C, S119R, T124N, T125S, K211R, D229G, A265V  
>RL42| codons 1-288
FLDGIDKAQEEHEKYHCNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGRN
FTSNSVKAACWWAGIKQEFGIPYNPQSQGVVESMDKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTRELQKQITKIQNFRVYYRGSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, L63P, I93L  
>RL42| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    P236L   E6K, I135V, S162C, T200A, V245M, Q278E, P313S, Q334L, F346Y, V417I, P420S, V435E, G436E, D460N, R461K, S468T, H483Y, L491V, V548I V90A
>RL42| codons 1-560
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEAQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHLDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKELCKLLRGTKALTEVIPLTEEAE
LELAENREILKESVHGVYYDPSKDLIAEIQKQGLGQWTYQIYQEPYKNLKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEAWWTEYWQATWIPEWEFINTS
PLVKLWYQLEKEPIEEAETFYVDGAANRETKLGKAGYVTNKGRQKVVTLTDTTNQKTELQ
AIYLALQDSGVEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQIDKLVSAGIRKVL

References
Author Title Citation
Graf, M Cloning and characterization of a virtually full-length HIV-1 genome from a subtype B'-Thai strain representing the most prevalent B-clade isolate in china. ARHR, 1998