<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
9196_01 9196_01 Germany 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  L74LM, T97A E11D, L101I, T112I, T122I, T124N, S195T, T206S, Y227F, L234I, S255N, D256E S283G
>9196_01| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIIMVAVHVASGYIEAEVIPAETGQEAAYFILKLAGRWPVKIIHTDNGSN
FISNTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYTAGERIVDIIASDIQTKELQKQITKIQNFRVYFRDSRDPIWKGPAK
LLWKGEGAVVIQDNNEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35D, M36I, R41K, C67G, H69K, V82I, L89M  
>9196_01| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEIGGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E40D, K43R, V60I, A98S, D123S, I135T, K173I, Q174K, D177E, T200A, Q207K, R211N, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E297A, D320E, D324E, I329V, Q334L, F346Y, R356K, M357R, R358G, G359S, A371V, Q394R, A400V, E413D, Q428R, K431T, V435A, F440Y, R461K, V466I, V467I, S468T, D471E, T477A, H483Q, L491S, V493I, K512R, S519N, A534S, A554S P247PST
>9196_01| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEREGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKSFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRKHLLNWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLTDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYEPSKELIAEVQKQGLGQWTYQIYQEPYKNLKTGKYAKRGSA
HTNDVKQLTEVVQKIATESIVIWGKTPKFKLPIRKETWEVWWTEYWQATWIPDWEFVNTP
PLVKLWYRLETEPIAGAETYYVDGAANRETKLGKAGYVTDKGRQKIITLTETTNQKAELQ
AIQLALQDSGSEINIVTDSQYALGIIQAQPDRSESELVNQIIEQLIKKEKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Harris, B Genomic characterization of a novel HIV type 1 B/G intersubtype recombinant strain from an injecting drug user in Germany. ARHR, 2005