<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB2059 MB2059 Kenya 1993 HIV1 D PBMC MC

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, M50L, I72V, T112V, I113V, T124A, T125A, V201I, T218I, L234I, D256E, A265V  
>MB2059| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQLKGEALHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGSN
FTSAAVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, I15V, G16X, M36I, R41K, I64V, H69R  
>MB2059| codons 1-99
PQITLWQRPVVTVKVXGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGRKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K32R, V35T, E36D, K49R, V60I, D121Y, K122E, D123E, I159V, D177E, I178M, T200I, Q207G, R211K, V245K, D250E, A272P, K275R, K277R, L282C, T286A, I293V, S322A, Q332L, G333R, G335E, Y342F, P345Q, F346Y, R356K, A360T, I375V, T377Q, S379C, K390R, A400T, T403A, V435I, V458I, H483N, L491V, S519N, A534S, A554N, V559I Q336K
>MB2059| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIRALTDICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAVFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIRVRQLCKCLRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPAKDLIAEIQKLRQEKWTYQIFQEQYKNLKTGKYAKMRGT
HTNDVKQLTEAVQKVAQECIVIWGKTPKFRLPIQKETWETWWAEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETFYVDGAANRETKLGKAGYITDRGRQKVVSLTDTTNQKTELQ
AINLALQDSGVEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLSWVPAHK
GIGGNEQVDKLVSNGIRKIL

References
Author Title Citation
Neilson, JR Subtypes of human immunodeficiency virus type 1 and disease stage among women in Nairobi, Kenya. J Virol, 1999