<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Q23-17 Q23-17 Kenya 1994 HIV1 A PBMC MC

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, A21T, V31I, I72V, L74V, T112I, I113V, T124A, T125A, G134N, K136Q, D167E, V201I, Q216H, L242F S283G
>Q23-17| codons 1-288
FLDGIDKAQEEHERYHSNWRTMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVIVVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKIVHTDNGSN
FTSAAVKAACWWANIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKHITKIQNFRVYYRDSRDPLWKGPAK
LFWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, E35D, M36I, R41K, R57K, H69K, L89M  
>Q23-17| codons 1-99
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  T215I     V35T, V60I, D121H, K122E, D123E, I135T, I142V, K173S, Q174K, D177E, T200A, Q207A, R211S, F214L, V245E, T286A, E291D, I293V, P294T, G335D, Y342F, M357K, G359S, K366R, T369A, A371V, I375V, A376V, T377M, K390R, E399D, A400T, T403M, E404D, P412L, E432D, V435A, R461K, D471E, Q480H, L491S, L517I, S519N, Q524K, K527E, E529D, A534S, A554S  
>Q23-17| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGLITPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQIFQEPFKNLKTGKYARKRSA
HTNDVRQLAEVVQKVVMESIVIWGKTPKFRLPIQKETWDTWWMDYWQATWILEWEFVNTP
PLVKLWYQLEKDPIAGAETFYVDGAANRETKLGKAGYVTDKGRQKVVSLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESEIVNQIIEKLIEKDKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Neilson, JR Subtypes of human immunodeficiency virus type 1 and disease stage among women in Nairobi, Kenya. J Virol, 1999