<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DJ264 DJ264 France 1991 HIV1 CRF02_AG PBMC Genomic

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, V31I, S39C, L101I, T112V, T124A, T125A, G134N, I135V, K136T, V201I, T206S, T218I, L234I, N254K, R269K S283G
>DJ264| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNLPPIVAKEIVACCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWANVTQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDKSDIKVVPRRKAKIIKDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, M36I, R41K, H69K, L89M  
>DJ264| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, T39A, D86G, I135V, S162A, K173I, Q174K, D177E, T200A, Q207E, R211K, V245Q, Y271F, K281R, T286A, E291D, V292I, I293V, S322A, G335D, R356K, M357R, G359S, A371V, I375V, K390S, K395R, T403M, E413D, E432D, R448K, D471E, Q480H, H483Y, L491S, K512R, S519N, Q524K, K527E, E529D, A534S, A554N G93R
>DJ264| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQGFWEVQLRIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRIKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIFAGIKVKQLCRLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPAKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKRRSA
HTNDVKQLTEVVQKVATESIVIWGKTPKFSLPIQRETWEAWWMEYWQATWIPDWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAANKETKLGKAGYVTDRGRQKVVSLTETTNQKTELH
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNQIIEKLIEKDKVYLSWVPAHK
GIGGNEQVDKLVSNGIRKVL

References
Author Title Citation
Carr, JK Full genome sequences of human immunodeficiency virus type 1 subtypes G and A/G intersubtype recombinants. Virology, 1998