<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SE6165 SE6165 Sweden 1993 HIV1 G PBMC Genomic

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, S17N, V31I, L74I, L101I, K111T, T112V, T124A, T125A, G134N, K136T, V201I, T206S, L234V, S255N, D256E S283G
>SE6165| codons 1-288
FLDGIDKAQEEHERYHNNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIIIVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVTVIHTDNGSN
FTSAAVKAACWWANITQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNNEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, M36I, I62V, L63P, C67S, H69K, V75I, V82I, L89M  
>SE6165| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEISGKKAIGTILVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, T39K, K43E, V60I, K122E, I142V, K166R, K173A, Q174N, D177E, I178M, T200A, Q207E, R211K, V245Q, E248D, D250E, A272P, K277T, Q278H, T286A, E291D, V292I, I293V, P294S, E297A, L301M, K311R, D324E, I329V, Q334L, G335D, F346Y, R356K, M357R, R358G, G359S, A371V, Q394R, A400I, E404D, Q428R, K431T, V435P, F440Y, R461K, R463K, V466I, V467I, S468T, D471E, T477A, H483Q, G490R, L491S, K512R, S515A, S519N, A534S, A554S  
>SE6165| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTRILEPFRANNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVTHLCKLLRGAKALTDIVSLTAEAE
MELAENREILREPVHGVYYDPSKELIAEVQKQGLDQWTYQIYQEPYKNLKTGKYAKRGSA
HTNDVKQLTEVVQKIATESIVIWGKTPKFKLPIRKETWEIWWTDYWQATWIPEWEFVNTP
PLVKLWYRLETEPIPGAETYYVDGAANRETKLGKAGYVTDKGKQKIITLTETTNQKAELQ
AIQLALQDSRSEVNIVTDSQYALGIIQAQPDRSEAELVNQIIEQLIKKEKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Carr, JK Full genome sequences of human immunodeficiency virus type 1 subtypes G and A/G intersubtype recombinants. Virology, 1998