<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
93BR020 93BR020 Brazil 1993 HIV1 F PBMC MC

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, L28I, P30A, I84L, S119T, T124A, K136Q, V165I, I200T, V201I, K211R, T218I, L234V, D256E S283G
>93BR020| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNIPAVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYLEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGTN
FTSATVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQIRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERTIDIIATDIQTRELQKQIIKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15V, E35D, M36V, R41K, R57K, Q61S, K70R, L89M, N98H  
>93BR020| codons 1-99
PQITLWQRPLVTIRVGGQLKEALLDTGADDTVLEDVNLPGKWKPKMIGGIGGFIKVKQYD
SILIEICGHRAIGTVLVGPTPVNIIGRNMLTQIGCTLHF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39M, I135T, I142V, S162Y, E169D, K173A, Q174K, Q207E, R211K, F214L, V245Q, E248D, A272P, T286A, E291D, V292I, I293V, E297T, V317A, R356K, G359S, A376S, T377L, K390R, Q394L, E399D, A400T, K431T, A446S, L452K, V466A, D471E, T477A, H483Q, L491S, S519N, A534S F130S
>93BR020| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICMEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTASTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQYSMTKILDPFRAKNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTTEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKMRSA
HTNDVKQLTEAVQKISLESIVIWGKTPKFRLPILKETWDTWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPIVGAETFYVDGASNRETKKGKAGYVTDRGRQKAVSLTETTNQKAELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLSWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Gao, F A comprehensive panel of near-full-length clones and reference sequences for non-subtype B isolates of human immunodeficiency virus type 1. J Virol, 1998