<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
97CDKFE4 97CDKFE4 DRC 1997 HIV1 A PBMC Genomic

Treatment History
Order Regimen Weeks
1 Unknown NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, S24Q, V31I, I72V, L101I, T112V, S119P, T124A, I135V, K136Q, K160R, V165I, V201I, T218I, L234I S283C
>97CDKFE4| codons 1-288
FLDGIDKAQEEHERYHSNWRAMAQDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGPN
FTSATVKAACWWAGVQQEFGIPYNPQSQGVVESMNKELKRIIGQIRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVACRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, K20R, E35D, M36I, R41K, L63A, H69K, K70R, L89M, T91V, I93L  
>97CDKFE4| codons 1-99
PQITLWQRPLVTVKIEGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIAIEICGKRAIGTVLVGPTPVNIIGRNMLVQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39G, K122E, T139S, A158S, K173S, Q174K, N175Y, D177E, I178M, T200A, Q207A, V245K, K281R, E291D, V292I, I293V, P294T, E297K, A304E, E312N, G335D, R356K, M357K, R358K, G359S, A360T, T377I, K390R, A400T, K431T, I434L, V435A, V466I, D471E, Q480H, H483Y, K512R, S519N, Q524K, K527E, K530R, A554S  
>97CDKFE4| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICGEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNESPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRSKYPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGTKALTDIVTLTKEAE
LELEENREILKNPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKKST
HTNDVKQLTEAVQKIAIESIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPLAGAETFYVDGAANRETKLGKAGYVTDRGRQKIVSLTETTNQKTELH
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDRSESELVNQIIEKLIEKERVYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Gao, F Evidence of two distinct subsubtypes within the HIV-1 subtype A radiation. ARHR, 2001