<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
96BW11 96BW11 Botswana 1997 HIV1 C PBMC Genomic

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D25E, V31I, M50I, I72V, F100Y, L101I, T112I, T124A, T125A, K136Q, V201I, I203M, T218I, L234I, A265V, D278A S283G
>96BW11| 1 | codons 1-288 | clone 1
FLDGIDKAQEEHEKYHSNWRAMASEFNLPPIVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYYILKLAGRWPVKIIHTDNGSN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDMIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGADCVAGRQDED
>96BW11| 2 | codons 1-288 | clone 2
FLDGIDKAQEEHEKYHSNWRAMASEFNLPPIVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYYILKLAGRWPVKIIHTDNGSN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEYLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDMIATDIQTRELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGADCVAGRQDED
>96BW11| 3 | codons 1-288 | clone 3
FLDGIDKAQEEHEKYHSNRRAMASEFNLPPIVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYYILKLAGRWPVKIIHTDNGSN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSARERIIDMIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGADCVAGRQDED
>96BW11| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASEFNLPPIVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYYILKLAGRWPVKIIHTDNGSN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDMIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGADCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, R41K, K43R, L63P, H69K, I93L  
>96BW11| 6 | codons 1-99 | clone 6
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF
>96BW11| 4 | codons 1-99 | clone 4
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF
>96BW11| B1 | codons 1-99 | clone B1
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLDF
>96BW11| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, S48T, K122E, D123S, A158S, K173A, Q174K, D177E, I178L, T200A, K201R, Q207K, P243S, V245K, D250E, A272P, I274V, K277R, T286A, E291D, V292I, I293V, Q334G, G335D, R356K, G359T, A376S, T377M, T386I, K390R, T397A, E404D, K431T, I434M, V435A, L452I, R461K, S468T, D471E, T477A, H483Q, L491P, S519N, A534S, Q547K, A554S  
>96BW11| 6 | codons 1-560 | clone 6
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRAKNPELVI
YQYMDDLYVGSDLEIGQHRAKIEELRKHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQSIKLPEKESWTVNDIQKLVGKLNWASQIYPGVKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGGDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKISMESIVIWGKIPKFRLPIQKEAWEAWWTDY*QATWIPEWEFVNTP
PLVKLWYQLETEPMAGAETFYVDGAANRETKIGKAGYVTDKGRQKVVTLTETTNQKAELQ
AIQLALQDSGPEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLSWVPAHK
GIGGNEKVDKLVSSGIRKVL
>96BW11| B1 | codons 1-560 | clone B1
PISPIETVPVKLKTGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPGNPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKHTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPELVI
YQYMDDLYVGSDLEIGQHRARIEELRNHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQSIKLPEKESWTVNDIQKLVGKLNWASQIYPGVKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGGDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKISMESIVIWGKIPKFRLPIQKEAWEAWWTDYWQATWIPEWEFVNTP
PLVKLWYQLETEPMAGAETFYVDGAANRETKIGKAGYVTDKGRQKVVTLTETTNQKAELQ
AIQLALQDSGPEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLSWVPAHK
GIGGNEKVDKLVSSGIRKVL
>96BW11| 4 | codons 1-560 | clone 4
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRAKNPELVI
YQYMDDLYVGSDLEIGQHRARIEELRKHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQSIKLPEKESWTVNDIQKLVGKLNWASQIYPGVKVRQLCKLLRGAKALTDIVPPTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGGDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKISMESIVIWGKIPKFRLPIQKEAWEAWWTDYWQATWIPEWEFVNTP
PLVKLWYQLETEPMAGAETFYVDGAANRETKIGKAGYVTDKGRQEVVTLTETTNQKAELQ
AIQLALQDSGPEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLSWVPAHK
GIGGNEKVDKLVSSGIREVL
>96BW11| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRAKNPELVI
YQYMDDLYVGSDLEIGQHRARIEELRKHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQSIKLPEKESWTVNDIQKLVGKLNWASQIYPGVKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGGDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKISMESIVIWGKIPKFRLPIQKEAWEAWWTDYWQATWIPEWEFVNTP
PLVKLWYQLETEPMAGAETFYVDGAANRETKIGKAGYVTDKGRQKVVTLTETTNQKAELQ
AIQLALQDSGPEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLSWVPAHK
GIGGNEKVDKLVSSGIRKVL

References
Author Title Citation
Novitsky, VA Molecular cloning and phylogenetic analysis of human immunodeficiency virus type 1 subtype C: A set of 23 full-length clones from Botswana. J Virol, 1999