<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
96BW01 96BW01 Botswana 1997 HIV1 C PBMC MMC

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, D25E, V31I, I72V, I84M, F100Y, L101I, T112V, S119T, T124A, T125A, K136Q, D167E, K188R, V201I, T218M, L234I, A265V, R269K, D278A S283G
>96BW01| 1 | codons 1-288 | clone 1
FLDGIDKAQEEHEKYHNNWRAMASEFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCGPGI
WQLDCTHLEGKVILVAVHVASGYMEAEVIPAETGQETAYYILKLAGRWPVKVIHTDNGTN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRRGGIGGYSAGERIIDIIATDIQTKELQKQIMKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIKDYGKQMAGADCVAGRQDED
>96BW01| 2 | codons 1-288 | clone 2
FLDGIDKAQEEHEKYHNNWRAMASEFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYMEAEVIPAETGQETAYYILKLAGRWPVKVIHTDNGTN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRRGGIGGYSAGERIIDIIATDIRTKELQKQIMKIRNFRVYYRDSRDPIWRGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIKDYGKQMAGADCVAGRQDED
>96BW01| 3 | codons 1-288 | clone 3
FLDGIDKAQEEHEKYHNNWRAMASEFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILAAVHVASGYMEAEVIPAETGQETAYYILKLAGRWPVKVIHTDNGTN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRRGGIGGYSAGERIIDIIATDIQTKELQKQIMKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIKDYGKQMAGADCVAGRQDED
>96BW01| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASEFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYMEAEVIPAETGQETAYYILKLAGRWPVKVIHTDNGTN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRRGGIGGYSAGERIIDIIATDIQTKELQKQIMKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIKDYGKQMAGADCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15V, L19I, M36I, R41K, H69K, L89M, I93L  
>96BW01| B3 | codons 1-99 | clone B3
PQITLWQRPLVTIRVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF
>96BW01| B21 | codons 1-99 | clone B21
PQITLWQRPLVTIRVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF
>96BW01| B22 | codons 1-99 | clone B22
PQITLWQRPLVTIRVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF
>96BW01| codons 1-99
PQITLWQRPLVTIRVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, S48T, K122E, D123G, K173A, Q174L, D177E, T200A, Q207E, R211K, V245N, D250E, A272P, K277R, T286A, E291D, V292I, I293V, Q334H, G335D, R356K, G359T, K390R, A400T, E404D, L452I, K465R, V466I, D471E, H483Q, L491S, S519N, K530R, A534S, A554S  
>96BW01| B22 | codons 1-560 | clone B22
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEMEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRALNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPINLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGHDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEEEPIVGAETFYVDGAANRETKIGKAGYVTDRGRQRIVSLTETTNQKTELQ
AIQLALQDSGSGVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKERVYLSWVPAHK
GIGGKEQVDKLVSSGIRKVL
>96BW01| B21 | codons 1-560 | clone B21
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEMEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRALNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPINLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGHDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEEEPIVGAETFYVDGAANRETKIGKAGYVTDRGRQRIVSLTETTNQKTELQ
AIQLALQDSGSGVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKERVYLSWVPAHK
GIGGKEQVDKLVSSGIRKVL
>96BW01| B3 | codons 1-560 | clone B3
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRALNPEIVI
YQYMDDLYVGPDLEIGQHTAKIEESKEHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPINLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGHDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWETWWTDYWQATWIPEWEFANTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKIGKAGYVTDRGRQRIVSLTETTNQKTELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKERVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL
>96BW01| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRALNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPINLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGHDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKIGKAGYVTDRGRQRIVSLTETTNQKTELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKERVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Novitsky, VA Molecular cloning and phylogenetic analysis of human immunodeficiency virus type 1 subtype C: A set of 23 full-length clones from Botswana. J Virol, 1999