<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BREPM275 BREPM275 Brazil 1999 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 RTI|PI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  V151I S17N, L28I, I72V, L101I, T112I, T124A, Q177L, T218I, L234V, D256E  
>BREPM275| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNIPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKIIHTDNGSN
FTSATVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVLMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L33F, N88D L10V, T12K, I13V, I15V, K20T, E35D, M36L, N37E, K55R, R57K, D60E, Q61N, L63S, L89M  
>BREPM275| codons 1-99
PQITLWQRPVVKVKVGGQLTEALLDTGADNTVFEDLELPGRWKPKMIGGIGGFIRVKQYE
NISIEICGHKAIGTVLVGPTPVNIIGRDMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y V75M K103N V108I K20R, L34I, V35M, T39A, E40F, K43E, V60I, V118I, K122E, D123E, D177N, G196E, H208Y, R211K, A272P, K281R, P294S, E297K, E312Q, R358K, A360T, K390R, E399D, A400I, V417I, K431T, V435P, A446S, N447S, L452M, T470M, H483Q, L491S, L517V, A534S, A554S  
>BREPM275| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKAIMEICAFLEEEGKISKIGPENPYNTPI
FAIKKKNSDKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSIPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPNIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEVISLTKEAE
LELAENREILKQPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMKGT
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWDIWWTEYWQATWIPEWEFINTP
PLVKLWYQLETEPIPGAETFYVDGASSRETKMGKAGYVTDRGRQKVVSLMDTTNQKTELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDKSESEVVSQIIEQLIKKEKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
de Sa Filho, DJ Analysis of full-length human immunodeficiency virus type 1 genome reveals a variable spectrum of subtypes B and f recombinants in Sao Paulo, Brazil. ARHR, 2005