<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BREPM108 BREPM108 Brazil 1999 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 RTI|PI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  L68I E11D, S17N, I72V, L74I, I84L, L101I, K111R, S119T, T125A, M154I, V165I, Q177L, F181Y, V201I, A205S, K211R, T218I, L234V, D256E S283G
>BREPM108| codons 1-288
FLDGIDKAQEDHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHIEGKVIIVAVHVASGYLEAEVIPAETGQETAYFILKLAGRWPVRTIHTDNGTN
FTSTAVKAACWWAGIKQEFGIPYNPQSQGVVESINKELKKIIGQIRDQAEHLKTAVLMAV
YIHNFKRKGGIGGYSAGERIIDIISTDIQTRELQKQIIKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, M36I, R41K, R57K, Q61N, L89M, I93L  
>BREPM108| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NILIEICGHKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V       P4Q, K20R, V118I, D121H, K122E, I135T, Q174H, F214L, A272P, K281R, E297K, S322T, I329L, E399D, A400L, K431T, V435A, A446S, L452T, V466A, S468P, D471E, T477A, H483Q, L491S, Q507L, L517I, S519N, A534S  
>BREPM108| codons 1-560
PISQIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKHNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPTKDLIAELQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWDLWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPIAGAETFYVDGASNRETKTGKAGYVTDRGRQKAVPLTETTNQKAELQ
AIQLALQDSGSEVNIVTDSQYALGIILAQPDKSESEIVNQIIEQLIKKEKVYLSWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
de Sa Filho, DJ Analysis of full-length human immunodeficiency virus type 1 genome reveals a variable spectrum of subtypes B and f recombinants in Sao Paulo, Brazil. ARHR, 2005